Skip to product information
1 of 1

Major urinary 6, Mouse (His-SUMO)

Major urinary 6, Mouse (His-SUMO)

Size

SKU:QM-0101520

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Major Urinary Protein 6 (MUP6) is crucial in chemical communication, binding to pheromones in male urine. This interaction significantly influences female sexual behavior, regulating mating behaviors and contributing to chemical signaling in reproductive and social contexts. MUP6's specific binding to male-derived pheromones underscores its essential role in mediating these communication processes in the animal kingdom. Major urinary protein 6 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Major urinary protein 6 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

  • Molecular Formula

    100038948 (Gene_ID) P02762 (M1-E180) (Accession)

  • Smiles

    MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0101520
1 EachQM-0101520
£0.00/ea
£0.00
£0.00/ea £0.00

Major urinary 6, Mouse (His-SUMO)

Major urinary 6, Mouse (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.