Major urinary 6, Mouse (His-SUMO)
Major urinary 6, Mouse (His-SUMO)
SKU:QM-0101520
Request quote or documents

Product Details
-
Description
Major Urinary Protein 6 (MUP6) is crucial in chemical communication, binding to pheromones in male urine. This interaction significantly influences female sexual behavior, regulating mating behaviors and contributing to chemical signaling in reproductive and social contexts. MUP6's specific binding to male-derived pheromones underscores its essential role in mediating these communication processes in the animal kingdom. Major urinary protein 6 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Major urinary protein 6 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
-
Molecular Formula
100038948 (Gene_ID) P02762 (M1-E180) (Accession)
-
Smiles
MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
Major urinary 6, Mouse (His-SUMO)
Major urinary 6, Mouse (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.