Skip to product information
1 of 1

MAP1LC3A, Human (His)

MAP1LC3A, Human (His)

Size

SKU:QM-0127479

Price on request
Quantity

Request quote or documents

View full details
  • Description

    MAP1LC3A is a key ubiquitin-like modifier essential for autophagosome vacuole formation, ensuring cellular homeostasis. As part of the GABARAP/GATE-16 subfamily, it plays a crucial role in late autophagosome maturation. MAP1LC3A Protein, Human (His) is the recombinant human-derived MAP1LC3A protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    84557 (Gene_ID) Q9H492-1 (M1-F121) (Accession)

  • Smiles

    MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0127479
1 EachQM-0127479
£0.00/ea
£0.00
£0.00/ea £0.00

MAP1LC3A, Human (His)

MAP1LC3A, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.