Skip to product information
1 of 1

MAP1LC3B, Human (His)

MAP1LC3B, Human (His)

Size

SKU:QM-0027541-01

£938.87 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    MAP1LC3B is a key ubiquitin-like modifier essential for the formation of autophagosome vacuoles, which maintains cellular homeostasis. In mitophagy, it regulates mitochondrial number, suppresses reactive oxygen species and ensures energy efficiency. MAP1LC3B Protein, Human (His) is the recombinant human-derived MAP1LC3B protein, expressed by E. coli , with C-His.

  • Molecular Formula

    81631 (Gene_ID) Q9GZQ8 (M1-V125) (Accession)

  • Smiles

    MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
50 µgQM-0027541-01
50 µgQM-0027541-01
£938.87/ea
£0.00
£938.87/ea £0.00
100 µgQM-0027541-02
100 µgQM-0027541-02
£1,458.88/ea
£0.00
£1,458.88/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

MAP1LC3B, Human (His)

MAP1LC3B, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.