MAP3K1, Mouse (His)
MAP3K1, Mouse (His)
SKU:QM-0093594
Request quote or documents

Product Details
-
Description
MAP3K1 is a key component of the protein kinase signal transduction cascade and plays a crucial role in cell signaling pathways.Through its kinase activity, MAP3K1 coordinates the activation of the ERK and JNK kinase pathways by phosphorylating MAP2K1 and MAP2K4.MAP3K1 Protein, Mouse (His) is the recombinant mouse-derived MAP3K1 protein, expressed by E.coli , with N-6*His labeled tag.
-
Molecular Formula
26401 (Gene_ID) P53349 (Q1216-W1493) (Accession)
-
Smiles
QPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVAVRCLELQPQDRPPSRELLKHPVFRTTW
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
MAP3K1, Mouse (His)
MAP3K1, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.