Skip to product information
1 of 1

MAP3K1, Mouse (His)

MAP3K1, Mouse (His)

Size

SKU:QM-0093594

Price on request
Quantity

Request quote or documents

View full details
  • Description

    MAP3K1 is a key component of the protein kinase signal transduction cascade and plays a crucial role in cell signaling pathways.Through its kinase activity, MAP3K1 coordinates the activation of the ERK and JNK kinase pathways by phosphorylating MAP2K1 and MAP2K4.MAP3K1 Protein, Mouse (His) is the recombinant mouse-derived MAP3K1 protein, expressed by E.coli , with N-6*His labeled tag.

  • Molecular Formula

    26401 (Gene_ID) P53349 (Q1216-W1493) (Accession)

  • Smiles

    QPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVAVRCLELQPQDRPPSRELLKHPVFRTTW

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0093594
1 EachQM-0093594
£0.00/ea
£0.00
£0.00/ea £0.00

MAP3K1, Mouse (His)

MAP3K1, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.