MARCH2, Human (Cell-Free, His, SUMO)
MARCH2, Human (Cell-Free, His, SUMO)
SKU:QM-0122215
Request quote or documents

Product Details
-
Description
The MARCH2 protein acts as an E3 ubiquitin protein ligase, promoting endocytosis and sorting of TFRC and CD86 to lysosomes. MARCH2 Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived MARCH2 protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag.
-
Molecular Formula
/ (Gene_ID) Q9P0N8 (M1-V246) (Accession)
-
Smiles
MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
MARCH2, Human (Cell-Free, His, SUMO)
MARCH2, Human (Cell-Free, His, SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.