Skip to product information
1 of 1

MARCH2, Human (Cell-Free, His, SUMO)

MARCH2, Human (Cell-Free, His, SUMO)

Size

SKU:QM-0122215

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The MARCH2 protein acts as an E3 ubiquitin protein ligase, promoting endocytosis and sorting of TFRC and CD86 to lysosomes. MARCH2 Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived MARCH2 protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag.

  • Molecular Formula

    / (Gene_ID) Q9P0N8 (M1-V246) (Accession)

  • Smiles

    MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0122215
1 EachQM-0122215
£0.00/ea
£0.00
£0.00/ea £0.00

MARCH2, Human (Cell-Free, His, SUMO)

MARCH2, Human (Cell-Free, His, SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.