Skip to product information
1 of 1

Matriptase/ST14 Catalytic Domain, Human (His)

Matriptase/ST14 Catalytic Domain, Human (His)

Size

SKU:QM-0205079-01

£55.02 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The Matriptase/ST14 catalytic domain protein originates from epithelial cells, forms a complex with HAI-1, and is activated by sphingosine-1-phosphate. It cleaves and activates hepatocyte growth factor/scatter factor and urokinase plasminogen activator, suggesting its role as an activator of other proteases and potential growth factors. Matriptase/ST14 Catalytic Domain Protein, Human (His) is the recombinant human-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    6768 (Gene_ID) NP_068813 (G596-V855) (Accession)

  • Smiles

    GSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205079-01
2 µgQM-0205079-01
£55.02/ea
£0.00
£55.02/ea £0.00
10 µgQM-0205079-02
10 µgQM-0205079-02
£111.63/ea
£0.00
£111.63/ea £0.00
50 µgQM-0205079-03
50 µgQM-0205079-03
£293.00/ea
£0.00
£293.00/ea £0.00
100 µgQM-0205079-04
100 µgQM-0205079-04
£437.58/ea
£0.00
£437.58/ea £0.00
250 µgQM-0205079-05
250 µgQM-0205079-05
£864.05/ea
£0.00
£864.05/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Matriptase/ST14 Catalytic Domain, Human (His)

Matriptase/ST14 Catalytic Domain, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.