Skip to product information
1 of 1

MCEMP1, Human (HEK293, Fc)

MCEMP1, Human (HEK293, Fc)

Size

SKU:QM-0204992-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    MCEMP1, a lung-specific surface protein, is a type II transmembran protein. MCEMP1 is primarily expressed in myeloid lineage immune cells and plays a critical in allergic and inflammatory lung diseases. MCEMP1 is an adaptor for KIT receptor to promotes stem cell factor-mediated mast cell proliferation. MCEMP1 also participates in the chemotaxis, adhesion, and migration of circulating monocytes[1][2]. MCEMP1 Protein, Human (HEK293, Fc) is the recombinant human-derived MCEMP1 protein, expressed by HEK293 , with N-mFc labeled tag.

  • Molecular Formula

    199675 (Gene_ID) Q8IX19-1 (K107-Q187) (Accession)

  • Smiles

    KNAEMSKELLGFKRELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204992-01
2 µgQM-0204992-01
£52.94/ea
£0.00
£52.94/ea £0.00
5 µgQM-0204992-02
5 µgQM-0204992-02
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0204992-03
10 µgQM-0204992-03
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0204992-04
50 µgQM-0204992-04
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0204992-05
100 µgQM-0204992-05
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

MCEMP1, Human (HEK293, Fc)

MCEMP1, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.