MCP-1/CCL2, Mouse

Name: MCP-1/CCL2, Mouse
Brand: QuantiMol
SKU: QM-0205289-01
Price: 67.44 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0205289-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
MCP-1/CCL2 Protein, Mouse is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse is a mouse MCP-1/CCL2 (Q24-R96) expressed by E.coil[1].
Molecular Formula
20296 (Gene_ID) P10148 (Q24-R96) (Accession)
Smiles
QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205289-01	2 µgQM-0205289-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0205289-02	10 µgQM-0205289-02 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

50 µgQM-0205289-03	50 µgQM-0205289-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0205289-04	100 µgQM-0205289-04 £714.61/ea	£0.00	Quantity	£714.61/ea	£0.00

500 µgQM-0205289-05	500 µgQM-0205289-05 £1,488.56/ea	£0.00	Quantity	£1,488.56/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MCP-1/CCL2, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.