MCP-2/CCL8, Human

Name: MCP-2/CCL8, Human
Brand: QuantiMol
SKU: QM-0199934-01
Price: 61.22 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0199934-01

£61.22 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
MCP-2/CCL8 Protein, Human is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Human is a recombinant human MCP-2/CCL8 (Q24-P99) protein expressed by E. coli[1][2].
Molecular Formula
6355 (Gene_ID) P80075 (Q24-P99) (Accession)
Smiles
QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0199934-01	2 µgQM-0199934-01 £61.22/ea	£0.00	Quantity	£61.22/ea	£0.00

10 µgQM-0199934-02	10 µgQM-0199934-02 £133.00/ea	£0.00	Quantity	£133.00/ea	£0.00

50 µgQM-0199934-03	50 µgQM-0199934-03 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MCP-2/CCL8, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.