MCV-type II Chemokine-like, Virus

Name: MCV-type II Chemokine-like, Virus
Brand: QuantiMol
SKU: QM-0198133-01
Price: 188.51 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0198133-01

£188.51 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
MCV-type II Chemokine-like Protein, Virus is the recombinant Virus-derived MCV-type II Chemokine-like protein, expressed by E. coli, with tag free.
Molecular Formula
/ (Gene_ID) O41924/AAB72041 (L25-L104) (Accession)
Smiles
LSRRKCCLNPTNRPIPRPLLQDLDKVDYQPMGHDCGREAFRVTLQDGRQGCVSVGNQSLLDWLKGHKDLCPRMWPGCESL
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0198133-01	5 µgQM-0198133-01 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

10 µgQM-0198133-02	10 µgQM-0198133-02 £288.14/ea	£0.00	Quantity	£288.14/ea	£0.00

50 µgQM-0198133-03	50 µgQM-0198133-03 £714.61/ea	£0.00	Quantity	£714.61/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MCV-type II Chemokine-like, Virus is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.