MDC/CCL22, Mouse

Name: MDC/CCL22, Mouse
Brand: QuantiMol
SKU: QM-0027578-01
Price: 55.02 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0027578-01

£55.02 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CCL22/MDC Protein, Mouse is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Mouse (His) is a recombinant mouse CCL22/MDC (G25-S92) protein expressed by E. coli.
Molecular Formula
20299 (Gene_ID) O88430 (G25-S92) (Accession)
Smiles
GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0027578-01	2 µgQM-0027578-01 £55.02/ea	£0.00	Quantity	£55.02/ea	£0.00

10 µgQM-0027578-02	10 µgQM-0027578-02 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

50 µgQM-0027578-03	50 µgQM-0027578-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0027578-04	100 µgQM-0027578-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

500 µgQM-0027578-05	500 µgQM-0027578-05 £1,466.69/ea	£0.00	Quantity	£1,466.69/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MDC/CCL22, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.