MDC/CCL22, Mouse (His, solution)

Name: MDC/CCL22, Mouse (His, solution)
Brand: QuantiMol
SKU: QM-0200911-01
Price: 136.63 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0200911-01

£136.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CCL22/MDC Protein, Mouse (His) is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Mouse (His) is a recombinant mouse CCL22/MDC (G25-S92) protein expressed by E. coli with a his tag[1][2].
Molecular Formula
20299 (Gene_ID) O88430 (G25-S92) (Accession)
Smiles
GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Purity
98
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0200911-01	10 µgQM-0200911-01 £136.63/ea	£0.00	Quantity	£136.63/ea	£0.00

50 µgQM-0200911-02	50 µgQM-0200911-02 £318.00/ea	£0.00	Quantity	£318.00/ea	£0.00

100 µgQM-0200911-03	100 µgQM-0200911-03 £462.58/ea	£0.00	Quantity	£462.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MDC/CCL22, Mouse (His, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.