MDC/CCL22, Rat

Name: MDC/CCL22, Rat
Brand: QuantiMol
SKU: QM-0001312-01
Price: 55.02 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0001312-01

£55.02 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CCL22/MDC Protein, Rat is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Rat is a recombinant rat CCL22/MDC (G25-A92) protein expressed by E. coli[1][2].
Molecular Formula
117551 (Gene_ID) Q5I0L5 (G25-A92) (Accession)
Smiles
GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0001312-01	2 µgQM-0001312-01 £55.02/ea	£0.00	Quantity	£55.02/ea	£0.00

10 µgQM-0001312-02	10 µgQM-0001312-02 £115.00/ea	£0.00	Quantity	£115.00/ea	£0.00

50 µgQM-0001312-03	50 µgQM-0001312-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0001312-04	100 µgQM-0001312-04 £470.39/ea	£0.00	Quantity	£470.39/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MDC/CCL22, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.