MDK/Midkine, Mouse

Name: MDK/Midkine, Mouse
Brand: QuantiMol
SKU: QM-0205338-01
Price: 64.33 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0205338-01

£64.33 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Midkine (MDK) is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration. MDK/Midkine Protein, Mouse is the recombinant mouse-derived Midkine protein, expressed by E. coli , with tag free.
Molecular Formula
17242 (Gene_ID) P12025 (K23-D140) (Accession)
Smiles
KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205338-01	5 µgQM-0205338-01 £64.33/ea	£0.00	Quantity	£64.33/ea	£0.00

10 µgQM-0205338-02	10 µgQM-0205338-02 £99.25/ea	£0.00	Quantity	£99.25/ea	£0.00

50 µgQM-0205338-03	50 µgQM-0205338-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0205338-04	100 µgQM-0205338-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

500 µgQM-0205338-05	500 µgQM-0205338-05 £1,178.73/ea	£0.00	Quantity	£1,178.73/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MDK/Midkine, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.