MDM2, Human

Name: MDM2, Human
Brand: QuantiMol
SKU: QM-0205307-01
Price: 217.16 GBP
Availability: InStock

Size 5 µg 10 µg 20 µg 50 µg 100 µg

SKU:QM-0205307-01

£217.16 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
MDM2 protein is a key E3 ubiquitin protein ligase that coordinates cellular processes by ubiquitinating and degrading p53/TP53 and inhibiting its tumor suppressor function. In addition to p53/TP53 regulation, MDM2 inhibits p53/TP53- and p73/TP73-mediated responses, self-ubiquitinates, and targets ARRB1 for degradation. MDM2 Protein, Human is the recombinant human-derived MDM2 protein, expressed by E. coli , with tag free.
Molecular Formula
4193 (Gene_ID) Q00987 (S17-N111) (Accession)
Smiles
SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN
Purity
98
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205307-01	5 µgQM-0205307-01 £217.16/ea	£0.00	Quantity	£217.16/ea	£0.00

10 µgQM-0205307-02	10 µgQM-0205307-02 £302.21/ea	£0.00	Quantity	£302.21/ea	£0.00

20 µgQM-0205307-03	20 µgQM-0205307-03 £417.63/ea	£0.00	Quantity	£417.63/ea	£0.00

50 µgQM-0205307-04	50 µgQM-0205307-04 £716.52/ea	£0.00	Quantity	£716.52/ea	£0.00

100 µgQM-0205307-05	100 µgQM-0205307-05 £1,104.11/ea	£0.00	Quantity	£1,104.11/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MDM2, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.