MEC/CCL28, Rat

Name: MEC/CCL28, Rat
Brand: QuantiMol
SKU: QM-0203529-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203529-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
MEC/CCL28 Protein, Rat is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Rat is a recombinant rat MEC/CCL28 (S20-R135) protein expressed by E. coli[1][2].
Molecular Formula
114492 (Gene_ID) Q91Y39 (S20-R135) (Accession)
Smiles
SEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDLAAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKHGTRRIHGTHDHEAPR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203529-01	2 µgQM-0203529-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0203529-02	10 µgQM-0203529-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0203529-03	50 µgQM-0203529-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0203529-04	100 µgQM-0203529-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MEC/CCL28, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.