METTL1, Human (His)

Name: METTL1, Human (His)
Brand: QuantiMol
SKU: QM-0201587-01
Price: 83.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0201587-01

£83.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N (7) -methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.
Molecular Formula
4234 (Gene_ID) Q9UBP6-1/NP_005362.3 (D32-Q265) (Accession)
Smiles
DHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ
Purity
98
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0201587-01	2 µgQM-0201587-01 £83.12/ea	£0.00	Quantity	£83.12/ea	£0.00

10 µgQM-0201587-02	10 µgQM-0201587-02 £126.50/ea	£0.00	Quantity	£126.50/ea	£0.00

50 µgQM-0201587-03	50 µgQM-0201587-03 £307.06/ea	£0.00	Quantity	£307.06/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

METTL1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.