Skip to product information
1 of 1

MGMT, Human (His)

MGMT, Human (His)

Size

SKU:QM-0193606-01

£122.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    MGMT Protein crucially defends against O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA, using a suicide reaction to repair methylated nucleobases. It stoichiometrically transfers the methyl group to a cysteine residue, but this process irreversibly inactivates MGMT. The sacrificial nature of MGMT's function emphasizes its commitment to safeguarding cellular DNA integrity at the expense of its own activity. MGMT Protein, Human (His) is the recombinant human-derived MGMT protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    4255 (Gene_ID) P16455 (M1-N207) (Accession)

  • Smiles

    MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0193606-01
5 µgQM-0193606-01
£122.00/ea
£0.00
£122.00/ea £0.00
10 µgQM-0193606-02
10 µgQM-0193606-02
£152.38/ea
£0.00
£152.38/ea £0.00
50 µgQM-0193606-03
50 µgQM-0193606-03
£384.82/ea
£0.00
£384.82/ea £0.00
100 µgQM-0193606-04
100 µgQM-0193606-04
£573.15/ea
£0.00
£573.15/ea £0.00
500 µgQM-0193606-05
500 µgQM-0193606-05
£1,458.88/ea
£0.00
£1,458.88/ea £0.00
1 mgQM-0193606-06
1 mgQM-0193606-06
£2,011.71/ea
£0.00
£2,011.71/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

MGMT, Human (His)

MGMT, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.