Skip to product information
1 of 1

MIA, Human (His)

MIA, Human (His)

Size

SKU:QM-0181698-01

£134.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    MIA proteins exhibit significant growth inhibitory effects on melanoma cells in vitro, extending their effects to various neuroectodermal tumors such as gliomas. In addition to playing an inhibitory role in cell growth, MIA proteins are also involved in molecular interactions, interacting with FASLG and TMIGD2. MIA Protein, Human (His) is the recombinant human-derived MIA protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    8190 (Gene_ID) Q16674 (G25-Q131) (Accession)

  • Smiles

    GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0181698-01
10 µgQM-0181698-01
£134.13/ea
£0.00
£134.13/ea £0.00
50 µgQM-0181698-02
50 µgQM-0181698-02
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

MIA, Human (His)

MIA, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.