Name: MICA, Cynomolgus (HEK293, His)
Brand: QuantiMol
SKU: QM-0205579-01
Price: 62.26 GBP
Availability: InStock

Product Details

Description
MICA Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MICA, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
123572792 (Gene_ID) AAO24115 (E1-P288) (Accession)
Smiles
ELHSLRYNVTVLSRDGSVQSEFLAEGHLDGQLFVRYDRETRRARPQGQWAEDVLGAKTWDTETGDLTENGKDLRMTLAHIKGQKGGLHSLQEIKVCEIHEDNSTGGLRHFYYDGELFLSQNLETQEWTELQSSRAQTLALNIRNFWKEDTMKTKTHYRAVQADCLKKLQRYLESGVAVRRTAPPMVNVTHSEASEGNITVTCRASGFYPRNIALTWRQDGVSLNHNAQQWGGILPDQNGTYQTWVATRIRQGEEQRFACYMEHSGNHSTHPVPSGKVLVFQSQWLDIP
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205579-01	5 µgQM-0205579-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0205579-02	10 µgQM-0205579-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0205579-03	50 µgQM-0205579-03 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

100 µgQM-0205579-04	100 µgQM-0205579-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

500 µgQM-0205579-05	500 µgQM-0205579-05 £1,173.88/ea	£0.00	Quantity	£1,173.88/ea	£0.00

1 mgQM-0205579-06	1 mgQM-0205579-06 £1,958.77/ea	£0.00	Quantity	£1,958.77/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MICA, Cynomolgus (HEK293, His)

MICA, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.