1 1

MIF, Human

MIF, Human

Size

QM-0205820-01

£81.92 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    MIF Protein, Human has assumed an important role as a pivotal regulator of innate immunity. MIF Protein, Human promotes the pro-inflammatory functions of immune cells.

  • Molecular Formula

    4282 (Gene_ID) P14174 (M1-A115) (Accession)

  • Smiles

    MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0205820-01
2 µgQM-0205820-01
£81.92/ea		 £0.00
£81.92/ea £0.00
10 µgQM-0205820-02
10 µgQM-0205820-02
£227.39/ea		 £0.00
£227.39/ea £0.00
50 µgQM-0205820-03
50 µgQM-0205820-03
£481.32/ea		 £0.00
£481.32/ea £0.00
100 µgQM-0205820-04
100 µgQM-0205820-04
£736.48/ea		 £0.00
£736.48/ea £0.00
500 µgQM-0205820-05
500 µgQM-0205820-05
£1,544.45/ea		 £0.00
£1,544.45/ea £0.00
1 mgQM-0205820-06
1 mgQM-0205820-06
£2,207.84/ea		 £0.00
£2,207.84/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

MIF, Human

MIF, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.