Skip to product information
1 of 1

MIF, Human (His)

MIF, Human (His)

Size

SKU:QM-0205549-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    4282 (Gene_ID) P14174 (M1-A115) (Accession)

  • Smiles

    MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205549-01
2 µgQM-0205549-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0205549-02
10 µgQM-0205549-02
£111.63/ea
£0.00
£111.63/ea £0.00
50 µgQM-0205549-03
50 µgQM-0205549-03
£305.15/ea
£0.00
£305.15/ea £0.00
100 µgQM-0205549-04
100 µgQM-0205549-04
£515.35/ea
£0.00
£515.35/ea £0.00
500 µgQM-0205549-05
500 µgQM-0205549-05
£1,377.99/ea
£0.00
£1,377.99/ea £0.00
1 mgQM-0205549-06
1 mgQM-0205549-06
£2,263.73/ea
£0.00
£2,263.73/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

MIF, Human (His)

MIF, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.