Skip to product information
1 of 1

MIF, Mouse (His)

MIF, Mouse (His)

Size

SKU:QM-0176480-01

£143.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (His) is the recombinant mouse-derived MIF protein, expressed by E.coli , with C-6*His labeled tag.

  • Molecular Formula

    17319 (Gene_ID) P34884 (P2-A115) (Accession)

  • Smiles

    PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0176480-01
10 µgQM-0176480-01
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0176480-02
50 µgQM-0176480-02
£404.78/ea
£0.00
£404.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

MIF, Mouse (His)

MIF, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.