Skip to product information
1 of 1

MIG/CXCL9, Rabbit (His-SUMO)

MIG/CXCL9, Rabbit (His-SUMO)

Size

SKU:QM-0110829

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The MIG/CXCL9 protein is part of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, MIG/CXCL9 may play a key role in regulating inflammatory processes and influencing cellular interactions. MIG/CXCL9 Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived MIG/CXCL9 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Molecular Formula

    103350772 (Gene_ID) U3KNX2 (S23-A124) (Accession)

  • Smiles

    SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0110829
1 EachQM-0110829
£0.00/ea
£0.00
£0.00/ea £0.00

MIG/CXCL9, Rabbit (His-SUMO)

MIG/CXCL9, Rabbit (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.