MIG/CXCL9, Rabbit (His-SUMO)
MIG/CXCL9, Rabbit (His-SUMO)
SKU:QM-0110829
Request quote or documents

Product Details
-
Description
The MIG/CXCL9 protein is part of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, MIG/CXCL9 may play a key role in regulating inflammatory processes and influencing cellular interactions. MIG/CXCL9 Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived MIG/CXCL9 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
-
Molecular Formula
103350772 (Gene_ID) U3KNX2 (S23-A124) (Accession)
-
Smiles
SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
MIG/CXCL9, Rabbit (His-SUMO)
MIG/CXCL9, Rabbit (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.