1 1

MIP-1 alpha/CCL3, Human (Trx-His)

MIP-1 alpha/CCL3, Human (Trx-His)

Size

QM-0027532

Price on request

Request quote or documents

View full details

Product Details

  • Description

    MIP-1 alpha/CCL3 Protein, Human, an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Human is a recombinant human CCL3 (S24-A92) expressed by E.coil[1].

  • Molecular Formula

    6348 (Gene_ID) P10147 (S24-A92) (Accession)

  • Smiles

    SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0027532
1 EachQM-0027532
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

MIP-1 alpha/CCL3, Human (Trx-His)

MIP-1 alpha/CCL3, Human (Trx-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.