MIP-3 alpha/CCL20, Mouse

Name: MIP-3 alpha/CCL20, Mouse
Brand: QuantiMol
SKU: QM-0201557-01
Price: 111.63 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg 500 µg

SKU:QM-0201557-01

£111.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
MIP-3 alpha/CCL20 Protein, Mouse is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Mouse is a recombinant mouse CCL20 (A28-M97) expressed by E. coli[1].
Molecular Formula
20297 (Gene_ID) O89093 (A28-M97) (Accession)
Smiles
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0201557-01	10 µgQM-0201557-01 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0201557-02	50 µgQM-0201557-02 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

100 µgQM-0201557-03	100 µgQM-0201557-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

500 µgQM-0201557-04	500 µgQM-0201557-04 £1,544.45/ea	£0.00	Quantity	£1,544.45/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MIP-3 alpha/CCL20, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.