Skip to product information
1 of 1

MOB4, Human (His)

MOB4, Human (His)

Size

SKU:QM-0172761-01

£216.46 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The MOB4 protein may be involved in membrane trafficking, specifically the membrane budding reaction, highlighting its role in vesicle formation and trafficking.MOB4 interacts with STRN4, suggesting involvement in protein-protein interactions.MOB4 Protein, Human (His) is the recombinant human-derived MOB4 protein, expressed by E.coli , with N-6*His labeled tag.

  • Molecular Formula

    25843 (Gene_ID) Q9Y3A3 (M1-A225) (Accession)

  • Smiles

    MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0172761-01
10 µgQM-0172761-01
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0172761-02
50 µgQM-0172761-02
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

MOB4, Human (His)

MOB4, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.