MUC-17, Human (HEK293, His)

Name: MUC-17, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0202861-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202861-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
MUC-17 protein maintains mucosal homeostasis, contributing to environmental stability. Interacting via its C-terminus, MUC-17 crucially associates with PDZK1, ensuring proper cellular localization. MUC-17 Protein, Human (HEK293, His) is the recombinant human-derived MUC-17 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
140453 (Gene_ID) Q685J3-1 (R4131-L4390) (Accession)
Smiles
RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202861-01	5 µgQM-0202861-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0202861-02	10 µgQM-0202861-02 £78.82/ea	£0.00	Quantity	£78.82/ea	£0.00

50 µgQM-0202861-03	50 µgQM-0202861-03 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

100 µgQM-0202861-04	100 µgQM-0202861-04 £348.89/ea	£0.00	Quantity	£348.89/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MUC-17, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.