Mucin-1/MUC1, Human (120a.a, HEK293, His)

Name: Mucin-1/MUC1, Human (120a.a, HEK293, His)
Brand: QuantiMol
SKU: QM-0205355-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 5 µg 10 µg 50 µg 100 µg

SKU:QM-0205355-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (120a.a, HEK293, His) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
4582 (Gene_ID) P15941-1 (L1036-G1155) (Accession)
Smiles
LSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAG
Purity
91
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205355-01	2 µgQM-0205355-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

5 µgQM-0205355-02	5 µgQM-0205355-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0205355-03	10 µgQM-0205355-03 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0205355-04	50 µgQM-0205355-04 £288.14/ea	£0.00	Quantity	£288.14/ea	£0.00

100 µgQM-0205355-05	100 µgQM-0205355-05 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Mucin-1/MUC1, Human (120a.a, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.