Skip to product information
1 of 1

Mucin-1/MUC1, Human (HEK293, mFc)

Mucin-1/MUC1, Human (HEK293, mFc)

Size

SKU:QM-0204192-01

£70.54 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (HEK293, mFc) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-mFc labeled tag.

  • Molecular Formula

    4582 (Gene_ID) P15941-1 (S1098-G1158) (Accession)

  • Smiles

    SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204192-01
5 µgQM-0204192-01
£70.54/ea
£0.00
£70.54/ea £0.00
10 µgQM-0204192-02
10 µgQM-0204192-02
£103.75/ea
£0.00
£103.75/ea £0.00
50 µgQM-0204192-03
50 µgQM-0204192-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0204192-04
100 µgQM-0204192-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Mucin-1/MUC1, Human (HEK293, mFc)

Mucin-1/MUC1, Human (HEK293, mFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.