Mucin-2/MUC2, Human (P.pastoris, His)

Name: Mucin-2/MUC2, Human (P.pastoris, His)
Brand: QuantiMol
SKU: QM-0127647-01
Price: 310.01 GBP
Availability: InStock

Size 20 µg 50 µg 100 µg

SKU:QM-0127647-01

£310.01 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Mucin-2/MUC2 Protein, Human (P.pastoris, His) is the recombinant human-derived Mucin-2/MUC2, expressed by P. pastoris , with N-6*His labeled tag.
Molecular Formula
4583 (Gene_ID) Q02817 (V36-L240) (Accession)
Smiles
VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0127647-01	20 µgQM-0127647-01 £310.01/ea	£0.00	Quantity	£310.01/ea	£0.00

50 µgQM-0127647-02	50 µgQM-0127647-02 £537.21/ea	£0.00	Quantity	£537.21/ea	£0.00

100 µgQM-0127647-03	100 µgQM-0127647-03 £830.03/ea	£0.00	Quantity	£830.03/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Mucin-2/MUC2, Human (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.