Skip to product information
1 of 1

Muellerian-inhibiting factor/AMH, Mouse (P.pastoris, His)

Muellerian-inhibiting factor/AMH, Mouse (P.pastoris, His)

Size

SKU:QM-0204333-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Mullerian inhibitory factor (AMH) plays a crucial role in various reproductive processes. It contributes significantly to Mullerian duct degeneration in male fetal sex differentiation. Muellerian-inhibiting factor/AMH Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Muellerian-inhibiting factor/AMH protein, expressed by P. pastoris , with N-His labeled tag.

  • Molecular Formula

    11705 (Gene_ID) P27106 (D450-C552) (Accession)

  • Smiles

    DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0204333-01
10 µgQM-0204333-01
£227.39/ea
£0.00
£227.39/ea £0.00
20 µgQM-0204333-02
20 µgQM-0204333-02
£337.95/ea
£0.00
£337.95/ea £0.00
50 µgQM-0204333-03
50 µgQM-0204333-03
£683.01/ea
£0.00
£683.01/ea £0.00
100 µgQM-0204333-04
100 µgQM-0204333-04
£1,063.31/ea
£0.00
£1,063.31/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Muellerian-inhibiting factor/AMH, Mouse (P.pastoris, His)

Muellerian-inhibiting factor/AMH, Mouse (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.