Skip to product information
1 of 1

MUSTN1, Human (His)

MUSTN1, Human (His)

Size

SKU:QM-0204909-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The MUSTN1 protein emerged as a potential regulator of musculoskeletal development and regeneration, coordinating key molecular events. Its specificity highlights its role in the complex signaling pathways that control musculoskeletal tissue. MUSTN1 Protein, Human (His) is the recombinant human-derived MUSTN1 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    389125 (Gene_ID) Q8IVN3 (M1-G82) (Accession)

  • Smiles

    MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204909-01
5 µgQM-0204909-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0204909-02
10 µgQM-0204909-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0204909-03
50 µgQM-0204909-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0204909-04
100 µgQM-0204909-04
£426.65/ea
£0.00
£426.65/ea £0.00
500 µgQM-0204909-05
500 µgQM-0204909-05
£1,100.97/ea
£0.00
£1,100.97/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

MUSTN1, Human (His)

MUSTN1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.