Skip to product information
1 of 1

MYBPC3, Human (His-SUMO)

MYBPC3, Human (His-SUMO)

Size

SKU:QM-0194559-01

£147.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    MYBPC3 Protein, positioned in the crossbridge region of vertebrate striated muscle A bands, binds to myosin heavy chain (MHC), F-actin, and native thin filaments, influencing actin-activated myosin ATPase. Its presence suggests potential modulation of muscle contraction, indicating a functional impact on the contractile apparatus, or a structural role in muscle fibers. MYBPC3 Protein, Human (His-SUMO) is the recombinant human-derived MYBPC3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Molecular Formula

    4607 (Gene_ID) Q14896-1 (M1-A328) (Accession)

  • Smiles

    MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0194559-01
5 µgQM-0194559-01
£147.63/ea
£0.00
£147.63/ea £0.00
10 µgQM-0194559-02
10 µgQM-0194559-02
£277.21/ea
£0.00
£277.21/ea £0.00
50 µgQM-0194559-03
50 µgQM-0194559-03
£542.08/ea
£0.00
£542.08/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

MYBPC3, Human (His-SUMO)

MYBPC3, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.