Name: MYDGF, Human (His)
Brand: QuantiMol
SKU: QM-0205837-01
Price: 52.94 GBP
Availability: InStock

Product Details

Description
The MYDGF protein is derived from bone marrow mononuclear cells and significantly promotes cardioprotection and post-myocardial infarction (MI) repair. Its functions include promoting cardiomyocyte survival and promoting adaptive angiogenesis. MYDGF Protein, Human (His) is the recombinant human-derived MYDGF protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
56005 (Gene_ID) Q969H8 (S33-L173) (Accession)
Smiles
SEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205837-01	2 µgQM-0205837-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0205837-02	10 µgQM-0205837-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

50 µgQM-0205837-03	50 µgQM-0205837-03 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

100 µgQM-0205837-04	100 µgQM-0205837-04 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

250 µgQM-0205837-05	250 µgQM-0205837-05 £526.28/ea	£0.00	Quantity	£526.28/ea	£0.00

500 µgQM-0205837-06	500 µgQM-0205837-06 £990.41/ea	£0.00	Quantity	£990.41/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

MYDGF, Human (His)

MYDGF, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.