Skip to product information
1 of 1

Myelin P0/MPZ, Human (HEK293, His)

Myelin P0/MPZ, Human (HEK293, His)

Size

SKU:QM-0179822-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Myelin protein P0 (MPZ) is a crucial adhesion molecule essential for normal myelination in the peripheral nervous system. Acting as an adhesion mediator between adjacent myelin wraps, MPZ plays a pivotal role in myelin compaction. Its homodimeric and homotetrameric structures underscore its significance in establishing necessary cellular interactions for myelin formation and integrity in the peripheral nervous system. Myelin protein P0/MPZ Protein, Human (HEK293, His) is the recombinant human-derived Myelin protein P0/MPZ protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    4359 (Gene_ID) P25189-1 (I30-R153) (Accession)

  • Smiles

    IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTR

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0179822-01
10 µgQM-0179822-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0179822-02
50 µgQM-0179822-02
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Myelin P0/MPZ, Human (HEK293, His)

Myelin P0/MPZ, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.