1 1

MYL12B, Human (His)

MYL12B, Human (His)

Size

QM-0026170

Price on request

Request quote or documents

View full details

Product Details

  • Description

    MYL12B Protein, Human (His) is the recombinant human-derived MYL12B protein, expressed by E. coli, with C-6*His tag.

  • Molecular Formula

    103910 (Gene_ID) O14950 (M1-D172) (Accession)

  • Smiles

    MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0026170
1 EachQM-0026170
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

MYL12B, Human (His)

MYL12B, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.