1 1

MYL9, Human (P. pastoris, His)

MYL9, Human (P. pastoris, His)

Size

QM-0026169

Price on request

Request quote or documents

View full details

Product Details

  • Description

    MYL9 Protein, Human (P. pastoris, His) is the recombinant human-derived MYL9 protein, expressed by P. pastoris, with C-10*His tag.

  • Molecular Formula

    13098 (Gene_ID) P24844 (S2-D117) (Accession)

  • Smiles

    SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0026169
1 EachQM-0026169
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

MYL9, Human (P. pastoris, His)

MYL9, Human (P. pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.