Myoglobin, Human (His)

Name: Myoglobin, Human (His)
Brand: QuantiMol
SKU: QM-0193550-01
Price: 162.5 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0193550-01

£162.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Myoglobin Protein, a globin family member, reserves oxygen and facilitates its movement in muscles. Myoglobin Protein, Human (His) is the recombinant human-derived Myoglobin protein, expressed by E. coli , with C-6*His labeled tag.
Molecular Formula
4151 (Gene_ID) P02144 (M1-G154) (Accession)
Smiles
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Purity
97
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0193550-01	10 µgQM-0193550-01 £162.50/ea	£0.00	Quantity	£162.50/ea	£0.00

50 µgQM-0193550-02	50 µgQM-0193550-02 £417.63/ea	£0.00	Quantity	£417.63/ea	£0.00

100 µgQM-0193550-03	100 µgQM-0193550-03 £629.04/ea	£0.00	Quantity	£629.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Myoglobin, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.