1 1

NA/Neuraminidase, H1N1 (AYV62750, HEK293, His)

NA/Neuraminidase, H1N1 (AYV62750, HEK293, His)

Size

QM-0193703-01

£72.61 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    NA (neuraminidase) proteins play a key role in viral transmission by catalyzing the removal of terminal sialic acid residues from viral and cellular glycoconjugates. NA plays a role in determining host range, limiting replication, and virulence. NA is associated with the development and progression of type 2 diabetes mellitus (T2D) . NA/Neuraminidase Protein, H1N1 (AYV62750, HEK293, His) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by HEK293 , with N-His labeled tag.

  • Molecular Formula

    / (Gene_ID) AYV62750 (H36-K469) (Accession)

  • Smiles

    HSIQLGSQNYTKTCTQSVITYENNTWVNQTYVNISNTNLAVGQSVVSAKLAGNSSLCPVSGWAIYSKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDQHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECVCVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRKGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTVWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0193703-01
5 µgQM-0193703-01
£72.61/ea		 £0.00
£72.61/ea £0.00
10 µgQM-0193703-02
10 µgQM-0193703-02
£111.63/ea		 £0.00
£111.63/ea £0.00
50 µgQM-0193703-03
50 µgQM-0193703-03
£316.08/ea		 £0.00
£316.08/ea £0.00
100 µgQM-0193703-04
100 µgQM-0193703-04
£501.98/ea		 £0.00
£501.98/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

NA/Neuraminidase, H1N1 (AYV62750, HEK293, His)

NA/Neuraminidase, H1N1 (AYV62750, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.