Nectin-2/CD112, Human (HEK293)

Name: Nectin-2/CD112, Human (HEK293)
Brand: QuantiMol
SKU: QM-0203888-01
Price: 71.58 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203888-01

£71.58 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Nectin-2/CD112 protein has dual roles in T-cell signaling: as a costimulator with CD226, promoting proliferation and cytokine production, and as a coinhibitor with PVRIG, inhibiting proliferation. It also acts as a cell adhesion protein and a receptor for certain viruses. Nectin-2/CD112 Protein, Human (HEK293) is the recombinant human-derived Nectin-2/CD112 protein, expressed by HEK293 , with tag free.
Molecular Formula
5819 (Gene_ID) Q92692-2/NP_002847.1 (Q32-L360) (Accession)
Smiles
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203888-01	5 µgQM-0203888-01 £71.58/ea	£0.00	Quantity	£71.58/ea	£0.00

10 µgQM-0203888-02	10 µgQM-0203888-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0203888-03	50 µgQM-0203888-03 £310.01/ea	£0.00	Quantity	£310.01/ea	£0.00

100 µgQM-0203888-04	100 µgQM-0203888-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Nectin-2/CD112, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.