Nectin-2/CD112, Human (HEK293, His)

Name: Nectin-2/CD112, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0180227-01
Price: 122.88 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0180227-01

£122.88 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CD112 Protein, Human (HEK293, His) is a recombinant human CD112 expressed in HEK 293 cells with a His tag at the N-terminus. Recombinant Human CD112 can be used as cell surface ligands for the human DNAM-1 (CD226) activating molecule[1][2].
Molecular Formula
5819 (Gene_ID) Q92692-2 (Q32-L360) (Accession)
Smiles
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPLHHHHHH
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0180227-01	10 µgQM-0180227-01 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

50 µgQM-0180227-02	50 µgQM-0180227-02 £365.90/ea	£0.00	Quantity	£365.90/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Nectin-2/CD112, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.