NEU2, Cricetulus griseus (sf9, His-Myc)
NEU2, Cricetulus griseus (sf9, His-Myc)
SKU:QM-0109426
Request quote or documents

Product Details
-
Description
The NEU2 protein plays a key role in cellular processes by catalyzing the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides, and gangliosides. Through its enzymatic activity, NEU2 contributes to the controlled modification of cell surface glycoconjugates, affecting various cellular functions including cell adhesion, signaling, and immune responses. NEU2 Protein, Cricetulus griseus (sf9, His-Myc) is the recombinant NEU2 protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.
-
Molecular Formula
100689301 (Gene_ID) Q64393 (M1-Q379) (Accession)
-
Smiles
MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
NEU2, Cricetulus griseus (sf9, His-Myc)
NEU2, Cricetulus griseus (sf9, His-Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.