Skip to product information
1 of 1

NEU2, Cricetulus griseus (sf9, His-Myc)

NEU2, Cricetulus griseus (sf9, His-Myc)

Size

SKU:QM-0109426

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The NEU2 protein plays a key role in cellular processes by catalyzing the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides, and gangliosides. Through its enzymatic activity, NEU2 contributes to the controlled modification of cell surface glycoconjugates, affecting various cellular functions including cell adhesion, signaling, and immune responses. NEU2 Protein, Cricetulus griseus (sf9, His-Myc) is the recombinant NEU2 protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.

  • Molecular Formula

    100689301 (Gene_ID) Q64393 (M1-Q379) (Accession)

  • Smiles

    MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0109426
1 EachQM-0109426
£0.00/ea
£0.00
£0.00/ea £0.00

NEU2, Cricetulus griseus (sf9, His-Myc)

NEU2, Cricetulus griseus (sf9, His-Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.