Skip to product information
1 of 1

Neuregulin-4/NRG4, Human

Neuregulin-4/NRG4, Human

Size

SKU:QM-0204247-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

  • Molecular Formula

    145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

  • Smiles

    GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

  • Purity

    94.2

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204247-01
2 µgQM-0204247-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0204247-02
10 µgQM-0204247-02
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0204247-03
50 µgQM-0204247-03
£437.58/ea
£0.00
£437.58/ea £0.00
100 µgQM-0204247-04
100 µgQM-0204247-04
£714.61/ea
£0.00
£714.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Neuregulin-4/NRG4, Human

Neuregulin-4/NRG4, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.