Skip to product information
1 of 1

Neuritin, Human (N-His)

Neuritin, Human (N-His)

Size

SKU:QM-0203146-01

£61.22 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Neutritin is a key factor in neural development, significantly enhancing neurite growth and branching in hippocampal and cortical cells. In the AMPA receptor (AMPAR) complex, neuronal proteins help form the outer core and regulate the function and properties of these receptors. Neuritin Protein, Human (N-His) is the recombinant human-derived Neuritin protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    51299 (Gene_ID) Q9NPD7 (A28-N115) (Accession)

  • Smiles

    AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203146-01
5 µgQM-0203146-01
£61.22/ea
£0.00
£61.22/ea £0.00
10 µgQM-0203146-02
10 µgQM-0203146-02
£91.38/ea
£0.00
£91.38/ea £0.00
50 µgQM-0203146-03
50 µgQM-0203146-03
£249.26/ea
£0.00
£249.26/ea £0.00
100 µgQM-0203146-04
100 µgQM-0203146-04
£387.77/ea
£0.00
£387.77/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Neuritin, Human (N-His)

Neuritin, Human (N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.