Skip to product information
1 of 1

Neurturin, Human

Neurturin, Human

Size

SKU:QM-0188223-01

£143.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Neurturin protein, vital in neurobiology, is key to supporting sympathetic neuron survival and implicated in regulating the central nervous system (CNS) . It influences neural growth, stability, and may modulate non-neuronal cell populations. Neurturin, a homodimer linked by disulfide bonds, maintains structural integrity for diverse cellular functions beyond neuronal survival. Neurturin Protein, Human is the recombinant human-derived Neurturin protein, expressed by E. coli , with tag free.

  • Molecular Formula

    4902 (Gene_ID) Q99748 (A96-V197) (Accession)

  • Smiles

    ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0188223-01
10 µgQM-0188223-01
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0188223-02
50 µgQM-0188223-02
£381.69/ea
£0.00
£381.69/ea £0.00
100 µgQM-0188223-03
100 µgQM-0188223-03
£604.04/ea
£0.00
£604.04/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Neurturin, Human

Neurturin, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.