NHP2, Human (His)
NHP2, Human (His)
SKU:QM-0108698
Request quote or documents

Product Details
-
Description
The NHP2 protein is essential for ribosome biogenesis and telomere maintenance and is a key component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex. In this complex, NHP2 catalyzes pseudouridylation of rRNA by isomerizing uridine, thereby stabilizing the rRNA conformation with up to 100 pseudouridine residues. NHP2 Protein, Human (His) is the recombinant human-derived NHP2 protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
55651 (Gene_ID) Q9NX24 (M1-L153) (Accession)
-
Smiles
MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
NHP2, Human (His)
NHP2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.