Skip to product information
1 of 1

NHP2, Human (His)

NHP2, Human (His)

Size

SKU:QM-0108698

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The NHP2 protein is essential for ribosome biogenesis and telomere maintenance and is a key component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex. In this complex, NHP2 catalyzes pseudouridylation of rRNA by isomerizing uridine, thereby stabilizing the rRNA conformation with up to 100 pseudouridine residues. NHP2 Protein, Human (His) is the recombinant human-derived NHP2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    55651 (Gene_ID) Q9NX24 (M1-L153) (Accession)

  • Smiles

    MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0108698
1 EachQM-0108698
£0.00/ea
£0.00
£0.00/ea £0.00

NHP2, Human (His)

NHP2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.