1 1

NIP30 Protein, Human (His)

NIP30 Protein, Human (His)

Size

QM-0107500

£629.04 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    The NIP30 protein negatively regulates proteasomal protein catabolism and protein binding activity. It is located in the nucleus and is expressed in various tissues including the brain and testis. NIP30 Protein, Human (HEK293, His) is the recombinant human-derived NIP30 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    80011 (Gene_ID) NP_079222 (M1-P254) (Accession)

  • Smiles

    MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP

  • Purity

    95

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.
Learn more
Variant Variant total Quantity Price Variant total
50 µgQM-0107500
50 µgQM-0107500
£629.04/ea		 £0.00
£629.04/ea £0.00

Related Products

Other industry favorites

NIP30 Protein, Human (His)

NIP30 Protein, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.