Skip to product information
1 of 1

NKG2A, Cynomolgus/Rhesus Macaque (HEK293, Fc)

NKG2A, Cynomolgus/Rhesus Macaque (HEK293, Fc)

Size

SKU:QM-0200871-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The NKG2A protein is an important immunosuppressive receptor that forms a complex with KLRD1 on lymphocyte subsets for self-non-self discrimination. It recognizes HLA-E loaded with self-peptides, monitors MHC class I expression in healthy cells, and promotes self-tolerance. NKG2A Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived NKG2A protein, expressed by HEK293 , with N-hFc labeled tag.

  • Molecular Formula

    102121106 (Gene_ID) Q68VD2/Q9MZJ2 (P94-L233) (Accession)

  • Smiles

    PSTLTQKHNNSSLNTRTQKACHCGHCPEEWITYSNSCYYIGKEKRTWAESLLACTLKNSSLLSIDNEEEMKFLTAISPSTWTGVFRDSSQHPWVTINGLTFKHEIKDSDNAEHNCAMLHARGLKSDRCGSSKIYHCKHKL

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0200871-01
5 µgQM-0200871-01
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0200871-02
10 µgQM-0200871-02
£111.63/ea
£0.00
£111.63/ea £0.00
50 µgQM-0200871-03
50 µgQM-0200871-03
£293.00/ea
£0.00
£293.00/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

NKG2A, Cynomolgus/Rhesus Macaque (HEK293, Fc)

NKG2A, Cynomolgus/Rhesus Macaque (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.