Skip to product information
1 of 1

NKG2D/CD314, Human (HEK293, Fc)

NKG2D/CD314, Human (HEK293, Fc)

Size

SKU:QM-0108708

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance, binding to multiple stress-inducing ligands on tumor and virus-infected cells.It plays a dual role by stimulating NK cells and enhancing T cell activation in CD8 (+) T cell-mediated adaptive responses.NKG2D/CD314 Protein, Human (HEK293, Fc) is the recombinant human-derived NKG2D/CD314 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    22914 (Gene_ID) P26718 (F78-V216) (Accession)

  • Smiles

    FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0108708
1 EachQM-0108708
£0.00/ea
£0.00
£0.00/ea £0.00

NKG2D/CD314, Human (HEK293, Fc)

NKG2D/CD314, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.