NKG2D/CD314, Human (HEK293, Fc)
NKG2D/CD314, Human (HEK293, Fc)
SKU:QM-0108708
Request quote or documents

Product Details
-
Description
The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance, binding to multiple stress-inducing ligands on tumor and virus-infected cells.It plays a dual role by stimulating NK cells and enhancing T cell activation in CD8 (+) T cell-mediated adaptive responses.NKG2D/CD314 Protein, Human (HEK293, Fc) is the recombinant human-derived NKG2D/CD314 protein, expressed by HEK293 , with C-hFc labeled tag.
-
Molecular Formula
22914 (Gene_ID) P26718 (F78-V216) (Accession)
-
Smiles
FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
NKG2D/CD314, Human (HEK293, Fc)
NKG2D/CD314, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.